PDB entry 2yqm

View 2yqm on RCSB PDB site
Description: Solution structure of the FYVE domain in zinc finger FYVE domain-containing protein 12
Class: protein transport
Keywords: NMR, FYVE domain, zinc finger FYVE domain-containing protein 12, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN TRANSPORT
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RUN and FYVE domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RUFY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96T51 (7-88)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d2yqma1, d2yqma2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yqmA (A:)
    gssgssgikevnqalkghawlkddeathcrqcekefsisrrkhhcrncghifcntcssne
    lalpsypkpvrvcdschtlllqrcsstas