PDB entry 2yqg

View 2yqg on RCSB PDB site
Description: Solution structure of the first cadherin domain from human Desmoglein-2
Class: cell adhesion
Keywords: cadherin, HDGC, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Desmoglein-2
  Species: Homo sapiens [TaxId:9606]
  Gene: DSG2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14126 (7-122)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2yqga1, d2yqga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yqgA (A:)
  gssgssgqkrawitapvalregedlskknpiakihsdlaeerglkitykytgkgiteppf
  gifvfnkdtgelnvtsildreetpfflltgyaldargnnvekplelrikvldindnepvf
  tqd