PDB entry 2yq0

View 2yq0 on RCSB PDB site
Description: kshv lana (orf73) c-terminal domain, octameric ring: cubic crystal form
Deposited on 2012-11-02, released 2013-11-13
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 3.91 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf 73
    Species: Human herpesvirus 8 type M [TaxId:435895]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2yq0A (A:)
    gsgvrmrrvpvthpkkphpryqqppvpyrqiddcpakarpqhifyrrflgkdgrrdpkcq
    wkfavifwgndpyglkklsqafqfggvkagpvsclphpgpdqspitycvyvycqnkdtsk
    kvqmarlaweashplagnlqssivkfkkplpltqpgenqg
    

    Sequence, based on observed residues (ATOM records):
    >2yq0A (A:)
    iddcpakarpqhifyrrflgkdgrrdpkcqwkfavifwgndpyglkklsqafqfggvkag
    pvsclphppitycvyvycqnkdtskkvqmarlaweashplagnlqssivkfkkplplt