PDB entry 2ypv

View 2ypv on RCSB PDB site
Description: Crystal structure of the Meningococcal vaccine antigen factor H binding protein in complex with a bactericidal antibody
Class: immune system
Keywords: immune system, vaccine, monoclonal antibody, mab, epitope mapping
Deposited on 2012-11-01, released 2013-02-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1834
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6QCC2 (Start-251)
      • expression tag (252)
  • Chain 'H':
    Compound: fab 12c1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YPV (0-217)
  • Chain 'L':
    Compound: fab 12c1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YPV (0-End)
    Domains in SCOPe 2.03: d2ypvl1, d2ypvl2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ypvL (L:)
    divltqspssiyaslgervtltckasqdihnylnwfqqkpgkspktliyranrlvdgvps
    rfsgggsgqdysltisslefedigiyyclqydefpptfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypvL (L:)
    divltqspssiyaslgervtltckasqdihnylnwfqqkpgkspktliyranrlvdgvps
    rfsgggsgqdysltisslefedigiyyclqydefpptfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn