PDB entry 2ypm

View 2ypm on RCSB PDB site
Description: crystal structure of ancestral thioredoxin relative to last animal and fungi common ancestor (lafca) from the precambrian period
Deposited on 2012-10-30, released 2013-08-21
The last revision was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lafca thioredoxin
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YPM (0-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2ypmA (A:)
    mviqvtnkdefesilseadklvvvdftatwcgpckmiapkfeelseeypdnvvflkvdvd
    evedvaaeygisamptfqffkngkkvdeltganqeklkamikkhaa
    

    Sequence, based on observed residues (ATOM records):
    >2ypmA (A:)
    mviqvtnkdefesilseadklvvvdftatwcgpckmiapkfeelseeypdnvvflkvdvd
    evedvaaeygisamptfqffkngkkvdeltganqeklkamikkha