PDB entry 2ypi

View 2ypi on RCSB PDB site
Description: crystallographic analysis of the complex between triosephosphate isomerase and 2-phosphoglycolate at 2.5-angstroms resolution. implications for catalysis
Deposited on 1990-01-12, released 1991-01-15
The last revision prior to the SCOP 1.57 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2ypia_
  • Chain 'B':
    Domains in SCOP 1.57: d2ypib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ypiA (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ypiB (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn