PDB entry 2ypg

View 2ypg on RCSB PDB site
Description: Haemagglutinin of 1968 Human H3N2 Virus in Complex with Human Receptor Analogue LSTc
Class: viral protein
Keywords: viral protein, receptor binding, membrane fusion, influenza virus evolution, glycoprotein
Deposited on 2012-10-30, released 2012-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.17771
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: INFLUENZA A VIRUS (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ypga_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: INFLUENZA A VIRUS (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ypgb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: INFLUENZA A VIRUS (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ypgc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: INFLUENZA A VIRUS (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ypgd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: INFLUENZA A VIRUS (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ypge_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: INFLUENZA A VIRUS (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ypgf_
  • Heterogens: NAG, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ypgA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypgA (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ypgB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypgB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ypgC (C:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypgC (C:)
    nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
    dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
    tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpst
    nqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvins
    ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpekq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ypgD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypgD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ypgE (E:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypgE (E:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ypgF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ypgF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi