PDB entry 2ypb

View 2ypb on RCSB PDB site
Description: Structure of the SCL:E47 complex bound to DNA
Deposited on 2012-10-30, released 2013-07-31
The last revision was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.25531
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell acute lymphocytic leukemia protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription factor E2-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ebox forward
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'F':
    Compound: ebox reverse
    Species: HOMO SAPIENS, synthetic [TaxId:9606]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2ypbA (A:)
    mgsshhhhhhsqdpeisdgphtkvvrriftnsrerwrqqnvngafaelrklipthppdkk
    lskneilrlamkyinflakllndqeeegtqr
    

    Sequence, based on observed residues (ATOM records):
    >2ypbA (A:)
    gphtkvvrriftnsrerwrqqnvngafaelrklipthppdkklskneilrlamkyinfla
    kllndqe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2ypbB (B:)
    madlsleekdlrdrerrmannarervrvrdineafrelgrmcqmhlksdkaqtkllilqq
    avqvilgleqqvrernlnpkaa
    

    Sequence, based on observed residues (ATOM records):
    >2ypbB (B:)
    sleekdlrdrerrmannarervrvrdineafrelgrmcqmhlksdkaqtkllilqqavqv
    ilgleqqvrernln
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.