PDB entry 2yoy

View 2yoy on RCSB PDB site
Description: Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate
Class: oxidoreductase
Keywords: oxidoreductase, cellulose oxidation, gh61, cellulose degradation
Deposited on 2012-10-29, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21085
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rbam17540
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yoya_
  • Chain 'B':
    Compound: rbam17540
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2yoyb_
  • Heterogens: CU1, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yoyA (A:)
    hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
    ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
    defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yoyB (B:)
    hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
    ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
    defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt