PDB entry 2yoo

View 2yoo on RCSB PDB site
Description: Cholest-4-en-3-one bound structure of CYP142 from Mycobacterium smegmatis
Class: oxidoreductase
Keywords: oxidoreductase, cholesterol metabolism
Deposited on 2012-10-25, released 2013-02-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.16768
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p450 heme-thiolate protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yooa_
  • Chain 'B':
    Compound: p450 heme-thiolate protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yoob_
  • Chain 'C':
    Compound: p450 heme-thiolate protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yooc_
  • Chain 'D':
    Compound: p450 heme-thiolate protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, K2B, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yooA (A:)
    mtqmltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpe
    lfsstggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidav
    cergecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmd
    tfaayteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrh
    tlsggteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelra
    gekimlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmterv
    lrrlpdlrladdapvplrpanfvsgpesmpvvftpsapvlahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yooA (A:)
    ltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpelfss
    tggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavcerg
    ecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdtfaa
    yteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrhtlsg
    gteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelrageki
    mlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervlrrl
    pdlrladdapvplrpanfvsgpesmpvvftpsapvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yooB (B:)
    mtqmltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpe
    lfsstggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidav
    cergecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmd
    tfaayteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrh
    tlsggteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelra
    gekimlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmterv
    lrrlpdlrladdapvplrpanfvsgpesmpvvftpsapvlahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yooB (B:)
    trpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpelfsst
    ggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavcerge
    cdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdtfaay
    teftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrhtlsgg
    teqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelragekim
    lmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervlrrlp
    dlrladdapvplrpanfvsgpesmpvvftpsapvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yooC (C:)
    mtqmltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpe
    lfsstggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidav
    cergecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmd
    tfaayteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrh
    tlsggteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelra
    gekimlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmterv
    lrrlpdlrladdapvplrpanfvsgpesmpvvftpsapvlahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yooC (C:)
    trpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpelfsst
    ggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavcerge
    cdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdtfaay
    teftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrhtlsgg
    teqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelragekim
    lmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervlrrlp
    dlrladdapvplrpanfvsgpesmpvvftpsapvl
    

  • Chain 'D':
    No sequence available.