PDB entry 2yoi

View 2yoi on RCSB PDB site
Description: crystal structure of ancestral thioredoxin relative to last eukaryotes common ancestor (leca) from the precambrian period
Deposited on 2012-10-24, released 2013-08-21
The last revision was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leca thioredoxin
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YOI (0-105)
  • Chain 'B':
    Compound: leca thioredoxin
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YOI (0-105)
  • Heterogens: CL, NA, MG, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2yoiA (A:)
mviqvtnkeefeailseadklvvvdffatwcgpckmiapffeelseeypdkvvfikvdvd
evpdvaakygitsmptfkffkngkkvdelvganqeklkqmilkhap

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2yoiB (B:)
mviqvtnkeefeailseadklvvvdffatwcgpckmiapffeelseeypdkvvfikvdvd
evpdvaakygitsmptfkffkngkkvdelvganqeklkqmilkhap