PDB entry 2ynv

View 2ynv on RCSB PDB site
Description: Cys221 oxidized, Mono zinc GIM-1 - GIM-1-Ox. Crystal structures of Pseudomonas aeruginosa GIM-1: active site plasticity in metallo-beta- lactamases
Class: hydrolase
Keywords: hydrolase, antibiotic resistance
Deposited on 2012-10-18, released 2013-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1994
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gim-1 protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ynva_
  • Chain 'B':
    Compound: gim-1 protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ynvb_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ynvA (A:)
    sqghkplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklll
    swatdrgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkd
    deftlgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswa
    dsiknivskkypiqmvvpghgkvgssdildhtidlaesasnklmqptaeasad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ynvA (A:)
    kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
    drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
    lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
    nivskkypiqmvvpghgkvgssdildhtidlaesasn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ynvB (B:)
    sqghkplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklll
    swatdrgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkd
    deftlgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswa
    dsiknivskkypiqmvvpghgkvgssdildhtidlaesasnklmqptaeasad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ynvB (B:)
    kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
    drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
    lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
    nivskkypiqmvvpghgkvgssdildhtidlaesasn