PDB entry 2ynd

View 2ynd on RCSB PDB site
Description: Plasmodium vivax N-myristoyltransferase in complex with a pyrazole sulphonamide inhibitor.
Class: transferase
Keywords: transferase, myristoylation, malaria, pyrazole sulphonamide
Deposited on 2012-10-13, released 2014-01-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.17045
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glycylpeptide N-tetradecanoyltransferase
  Species: Plasmodium vivax [TaxId:5855]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5K1A2 (0-384)
  Domains in SCOPe 2.03: d2ynda1
• Chain 'B':
  Compound: Glycylpeptide N-tetradecanoyltransferase
  Species: Plasmodium vivax [TaxId:5855]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5K1A2 (0-384)
• Chain 'C':
  Compound: Glycylpeptide N-tetradecanoyltransferase
  Species: Plasmodium vivax [TaxId:5855]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A5K1A2 (Start-384)
• Heterogens: DMS, NHW, 646, SO4, MG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yndA (A:)
  idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
  eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
  tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
  vsdaryyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvh
  kllgsyleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgnd
  kystlnaaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegd
  gslkyylynwkcasfapahvgivll
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.