PDB entry 2ymz

View 2ymz on RCSB PDB site
Description: Crystal structure of chicken Galectin 2
Class: sugar binding protein
Keywords: sugar binding protein, carbohydrate recognition
Deposited on 2012-10-11, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19112
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C0Z4 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2ymza1, d2ymza2
  • Chain 'B':
    Compound: galectin 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C0Z4 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2ymzb1, d2ymzb2
  • Chain 'C':
    Compound: galectin 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C0Z4 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2ymzc1, d2ymzc2
  • Chain 'D':
    Compound: galectin 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C0Z4 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2ymzd1, d2ymzd2
  • Chain 'E':
    Compound: galectin 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C0Z4 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2ymze1, d2ymze2
  • Chain 'F':
    Compound: galectin 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C0Z4 (2-129)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2ymzf1, d2ymzf2
  • Heterogens: SO4, LAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymzA (A:)
    armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
    sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
    gfkvtsfkve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymzB (B:)
    armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
    sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
    gfkvtsfkve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymzC (C:)
    armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
    sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
    gfkvtsfkve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymzD (D:)
    armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
    sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
    gfkvtsfkve
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymzE (E:)
    armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
    sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
    gfkvtsfkve
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymzF (F:)
    armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
    sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
    gfkvtsfkve