PDB entry 2ymu

View 2ymu on RCSB PDB site
Description: Structure of a highly repetitive propeller structure
Class: unknown function
Keywords: unknown function, two domains
Deposited on 2012-10-10, released 2012-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.1755
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wd-40 repeat protein
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2J0I0 (4-576)
      • expression tag (0-3)
      • conflict (335)
    Domains in SCOPe 2.07: d2ymua1, d2ymua2, d2ymua3
  • Chain 'B':
    Compound: wd-40 repeat protein
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2J0I0 (4-576)
      • expression tag (0-3)
      • conflict (335)
    Domains in SCOPe 2.07: d2ymub1, d2ymub2, d2ymub3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymuA (A:)
    gshmgvkernrleahsssvrgvafspdgqtiasasddktvklwnrngqllqtltghsssv
    wgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddk
    tvklwnrngqllqtltghsssvwgvafspdgqtiasasddktvklwnrngqllqtltghs
    ssvwgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasas
    ddktvklwnrngqllqtltghsssvngvafrpdgqtiasasddktvklwnrngqllqtlt
    ghsssvwgvafspdgqtiasasddktvklwnrngqhlqtltghsssvwgvafspdgqtia
    sasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddktvklwnrngqllq
    tltghsssvwgvafspddqtiasasddktvklwnrngqllqtltghsssvrgvafspdgq
    tiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddktvklwnrngq
    llqtltghsssvwgvafspdgqtiasassdktvklwn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ymuB (B:)
    gshmgvkernrleahsssvrgvafspdgqtiasasddktvklwnrngqllqtltghsssv
    wgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddk
    tvklwnrngqllqtltghsssvwgvafspdgqtiasasddktvklwnrngqllqtltghs
    ssvwgvafspdgqtiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasas
    ddktvklwnrngqllqtltghsssvngvafrpdgqtiasasddktvklwnrngqllqtlt
    ghsssvwgvafspdgqtiasasddktvklwnrngqhlqtltghsssvwgvafspdgqtia
    sasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddktvklwnrngqllq
    tltghsssvwgvafspddqtiasasddktvklwnrngqllqtltghsssvrgvafspdgq
    tiasasddktvklwnrngqllqtltghsssvrgvafspdgqtiasasddktvklwnrngq
    llqtltghsssvwgvafspdgqtiasassdktvklwn