PDB entry 2ymj

View 2ymj on RCSB PDB site
Description: solution structure of the qua1 dimerization domain of pxqua, the xenopus ortholog of quaking.
Deposited on 2012-10-09, released 2013-10-30
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein quaking-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q32NN2 (2-51)
      • expression tag (0-1)
      • engineered mutation (29)
  • Chain 'B':
    Compound: protein quaking-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q32NN2 (2-51)
      • expression tag (0-1)
      • engineered mutation (29)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ymjA (A:)
    gskekpkptpdylmqlmndkklmsslpnfsgifthlerlldeeisrvrkdmy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2ymjB (B:)
    gskekpkptpdylmqlmndkklmsslpnfsgifthlerlldeeisrvrkdmy