PDB entry 2ym9

View 2ym9 on RCSB PDB site
Description: SipD from Salmonella typhimurium
Class: cell invasion
Keywords: cell invasion, type 3 secretion, t3ss, needle tip protein, host pathogen interaction, bacterial pathogenesis, tip complex
Deposited on 2011-06-06, released 2011-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cell invasion protein sipD
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:216597]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56026
• Chain 'B':
  Compound: Cell invasion protein sipD
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:216597]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56026
• Chain 'C':
  Compound: Cell invasion protein sipD
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:216597]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56026 (Start-345)
  Domains in SCOPe 2.08: d2ym9c_
• Chain 'D':
  Compound: Cell invasion protein sipD
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:216597]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56026 (Start-345)
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2ym9C (C:)
  gshmlniqnysasphpgivaerpqtpsasehvetavvpsttehrgtdiislsqaatkihq
  aqqtlqstppiseenndertlarqqltsslnalaksgvslsaeqnenlrsafsaptsalf
  saspmaqprttisdaeiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggw
  llpgkdgntvkldvtslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlse
  lnlpnsclksygsgyvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaq
  eenmkttlqtltqkysnanslydnlvkvlsstisssletaksflqg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ym9C (C:)
  tisdaeiwdmvsqnisaigdsylgvyenvvavytdfyqafsdilskmggwllpgkdgntv
  kldvtslkndlnslvnkynqinsntvlfpaqsgsgvkvateaearqwlselnlpnsclks
  ygsgyvvtvdltplqkmvqdidglgapgkdsklemdnakyqawqsgfkaqeenmkttlqt
  ltqkysnanslydnlvkvlsstisssletaksflqg
  

  
  
• Chain 'D':
  No sequence available.