PDB entry 2ym3

View 2ym3 on RCSB PDB site
Description: Crystal structure of checkpoint kinase 1 (Chk1) in complex with inhibitors
Class: transferase
Keywords: transferase, DNA repair
Deposited on 2011-06-06, released 2012-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.1788
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ym3a_
  • Heterogens: YM3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ym3A (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ym3A (A:)
    dwdlvqtlgevqlavnrvteeavavkivdnikkeicinkmlnhenvvkfyghrreiqylf
    leycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenlllderdn
    lkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgivltamla
    gelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsaritipdikkdr
    wynkplk