PDB entry 2ylp

View 2ylp on RCSB PDB site
Description: targeting the binding function 3 site of the androgen receptor through in silico molecular modeling
Class: hormone receptor
Keywords: hormone receptor, binding function 3
Deposited on 2011-06-04, released 2011-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19747
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ylpa_
  • Heterogens: SO4, TES, 056, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ylpA (A:)
    iegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalp
    gfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysq
    cvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriia
    ckrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqv
    pkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ylpA (A:)
    piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
    ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
    sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
    scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
    vkpiyfhtq