PDB entry 2ylk

View 2ylk on RCSB PDB site
Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
Class: hydrolase
Keywords: hydrolase, cellulose binding protein
Deposited on 2011-06-02, released 2012-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1753
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59325 (1-144)
      • expression tag (0)
      • conflict (15)
    Domains in SCOPe 2.07: d2ylka1, d2ylka2
  • Chain 'B':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59325 (1-144)
      • conflict (15)
    Domains in SCOPe 2.07: d2ylkb_
  • Chain 'C':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59325 (1-144)
      • conflict (15)
    Domains in SCOPe 2.07: d2ylkc_
  • Chain 'D':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59325 (1-144)
      • conflict (15)
    Domains in SCOPe 2.07: d2ylkd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ylkA (A:)
    mdvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytp
    igsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpt
    ikafqdygkvtlykngelvwgtppg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ylkB (B:)
    mdvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytp
    igsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpt
    ikafqdygkvtlykngelvwgtppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ylkB (B:)
    dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
    gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
    kafqdygkvtlykngelvwgtppg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ylkC (C:)
    mdvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytp
    igsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpt
    ikafqdygkvtlykngelvwgtppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ylkC (C:)
    dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
    gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
    kafqdygkvtlykngelvwgtppg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ylkD (D:)
    mdvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytp
    igsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpt
    ikafqdygkvtlykngelvwgtppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ylkD (D:)
    dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
    gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
    kafqdygkvtlykngelvwgtppg