PDB entry 2ylc

View 2ylc on RCSB PDB site
Description: structure of salmonella typhimurium hfq in complex with u6 RNA
Class: RNA-binding protein
Keywords: RNA-binding protein, lsm protein, RNA chaperone
Deposited on 2011-06-01, released 2011-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.1342
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ylca_
  • Heterogens: SCN, U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ylcA (A:)
gamakgqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykha
istvvpsrpvshhs

    Sequence, based on observed residues (ATOM records): (download) 
    >2ylcA (A:)
qslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
srpvsh