PDB entry 2ykl

View 2ykl on RCSB PDB site
Description: Structure of human anti-nicotine Fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
Class: immune system
Keywords: immune system, monoclonal antibodies, anti-smoking vaccine
Deposited on 2011-05-27, released 2011-11-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21658
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YKL (Start-211)
  • Chain 'L':
    Compound: Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YKL
    Domains in SCOPe 2.04: d2ykll1, d2ykll2
  • Heterogens: NLD, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2yklL (L:)
    qseltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvp
    drfsgsksgtsaslaisglrsedeadyycaawddslsawvfgggtqldilgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yklL (L:)
    eltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvpdr
    fsgsksgtsaslaisglrsedeadyycaawddslsawvfgggtqldilgqpkaapsvtlf
    ppssatlvclisdfypgavtvawkadsspgvetttpskqsnnkyaassylsltpeqwksh
    rsyscqvthegstvektvap