PDB entry 2yka

View 2yka on RCSB PDB site
Description: RRM domain of mRNA export adaptor REF2-I bound to HVS ORF57 peptide
Deposited on 2011-05-26, released 2012-06-13
The last revision was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA and export factor-binding protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JJW6 (13-115)
      • expression tag (0-12)
      • expression tag (116-123)
  • Chain 'B':
    Compound: 52 kda immediate-early phosphoprotein
    Species: SAIMIRIINE HERPESVIRUS 2 [TaxId:10381]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13199 (5-22)
      • expression tag (0-4)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2ykaA (A:)
masmtggqqmgrdpdkwqhdlfdsgcgggegvetgakllvsnldfgvsdadiqelfaefg
tlkkaavdydrsgrslgtadvhferradalkamkqykgvpldgrpmdiqlvasqidlehh
hhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2ykaB (B:)
gplgsscktswadrvreaaaqrr