PDB entry 2yjd

View 2yjd on RCSB PDB site
Description: Stapled peptide bound to Estrogen Receptor Beta
Class: hormone receptor/peptide
Keywords: hormone receptor-peptide complex
Deposited on 2011-05-19, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yjdb_
  • Chain 'C':
    Compound: stapled peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YJD
  • Chain 'D':
    Compound: stapled peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YJD
  • Heterogens: YJD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yjdB (B:)
    dalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfv
    elslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdml
    lattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwv
    iaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjdB (B:)
    lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
    slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
    ttsrfrelklqhkeylcvkamillnssssrklahllnavtdalvwviaksgissqqqsmr
    lanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.