PDB entry 2yix

View 2yix on RCSB PDB site
Description: triazolopyridine inhibitors of p38
Class: transferase
Keywords: phosphorylation, serine/threonine-protein kinase, transferase
Deposited on 2011-05-17, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1959
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yixa_
  • Heterogens: YIX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yixA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld