PDB entry 2yiw

View 2yiw on RCSB PDB site
Description: triazolopyridine inhibitors of p38 kinase
Class: transferase
Keywords: transferase, inhibitor sbdd kinase, cell cycle
Deposited on 2011-05-17, released 2011-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2227
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yiwa_
  • Heterogens: YIW, I46, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yiwA (A:)
    sqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqs
    iihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqk
    ltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtg
    yvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgt
    pgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaq
    alahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yiwA (A:)
    rptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlntddhvqfliyqil
    rglkyihsadiihrdlkpsnlavnedcelkildfyvatrwyrapeimlnwmhynqtvdiw
    svgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpk
    mnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsf
    esrdllidewksltydevisfvpppl