PDB entry 2yho

View 2yho on RCSB PDB site
Description: the idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Class: ligase
Keywords: ligase, e2 ligase-e3 ligase complex, ring zinc-finger, ubl conjugation pathway
Deposited on 2011-05-04, released 2011-06-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1881
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: e3 ubiquitin-protein ligase mylip
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WY64
• Chain 'B':
  Compound: ubiquitin-conjugating enzyme e2 d1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51668 (2-148)
    • expression tag (0-1)
  Domains in SCOPe 2.03: d2yhob_
• Chain 'C':
  Compound: e3 ubiquitin-protein ligase mylip
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WY64
• Chain 'D':
  Compound: ubiquitin-conjugating enzyme e2 d1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51668 (2-148)
    • expression tag (0-1)
  Domains in SCOPe 2.03: d2yhod_
• Chain 'E':
  Compound: e3 ubiquitin-protein ligase mylip
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WY64
• Chain 'F':
  Compound: ubiquitin-conjugating enzyme e2 d1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51668 (2-148)
    • expression tag (0-1)
  Domains in SCOPe 2.03: d2yhof_
• Chain 'G':
  Compound: e3 ubiquitin-protein ligase mylip
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WY64
• Chain 'H':
  Compound: ubiquitin-conjugating enzyme e2 d1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51668 (2-148)
  Domains in SCOPe 2.03: d2yhoh_
• Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhoB (B:)
  gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
  dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
  lvpdiaqiyksdkekynrharewtqkyam
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhoD (D:)
  gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
  dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
  lvpdiaqiyksdkekynrharewtqkyam
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhoF (F:)
  gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
  dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
  lvpdiaqiyksdkekynrharewtqkyam
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >2yhoH (H:)
  gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
  dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
  lvpdiaqiyksdkekynrharewtqkyam
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yhoH (H:)
  malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy
  pfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv
  pdiaqiyksdkekynrharewtqkyam