PDB entry 2yho

View 2yho on RCSB PDB site
Description: the idol-ube2d complex mediates sterol-dependent degradation of the ldl receptor
Class: ligase
Keywords: ligase, e2 ligase-e3 ligase complex, ring zinc-finger, ubl conjugation pathway
Deposited on 2011-05-04, released 2011-06-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1881
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e3 ubiquitin-protein ligase mylip
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51668 (2-148)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d2yhob_
  • Chain 'C':
    Compound: e3 ubiquitin-protein ligase mylip
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51668 (2-148)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d2yhod_
  • Chain 'E':
    Compound: e3 ubiquitin-protein ligase mylip
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51668 (2-148)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d2yhof_
  • Chain 'G':
    Compound: e3 ubiquitin-protein ligase mylip
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ubiquitin-conjugating enzyme e2 d1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yhoh_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yhoB (B:)
    gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
    dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
    lvpdiaqiyksdkekynrharewtqkyam
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yhoD (D:)
    gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
    dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
    lvpdiaqiyksdkekynrharewtqkyam
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yhoF (F:)
    gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
    dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
    lvpdiaqiyksdkekynrharewtqkyam
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yhoH (H:)
    gamalkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfpt
    dypfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
    lvpdiaqiyksdkekynrharewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yhoH (H:)
    malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy
    pfkppkiafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv
    pdiaqiyksdkekynrharewtqkyam