PDB entry 2yhf

View 2yhf on RCSB PDB site
Description: 1.9 angstrom crystal structure of clec5a
Class: immune system
Keywords: immune system
Deposited on 2011-04-30, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfa_
• Chain 'B':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfb_
• Chain 'C':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfc_
• Chain 'D':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfd_
• Chain 'E':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfe_
• Chain 'F':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhff_
• Chain 'G':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfg_
• Chain 'H':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfh_
• Chain 'I':
  Compound: c-type lectin domain family 5 member a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NY25 (0-117)
    • engineered mutation (0)
  Domains in SCOPe 2.06: d2yhfi_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfA (A:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfB (B:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfC (C:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfD (D:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfE (E:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfF (F:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfG (G:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfH (H:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yhfI (I:)
  mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
  gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna