PDB entry 2yhe

View 2yhe on RCSB PDB site
Description: Structure determination of the stereoselective inverting sec- alkylsulfatase Pisa1 from Pseudomonas sp.
Class: hydrolase
Keywords: hydrolase, inversion, metallo-beta-lactamase fold
Deposited on 2011-04-29, released 2012-05-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18492
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sec-alkyl sulfatase
    Species: PSEUDOMONAS SP. DSM 6611 [TaxId:1007495]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8KAY7 (Start-659)
      • conflict (106)
      • expression tag (660-667)
    Domains in SCOPe 2.03: d2yhea1, d2yhea2
  • Chain 'B':
    Compound: sec-alkyl sulfatase
    Species: PSEUDOMONAS SP. DSM 6611 [TaxId:1007495]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8KAY7 (Start-659)
      • conflict (106)
      • expression tag (660-662)
    Domains in SCOPe 2.03: d2yheb1, d2yheb2
  • Chain 'C':
    Compound: sec-alkyl sulfatase
    Species: PSEUDOMONAS SP. DSM 6611 [TaxId:1007495]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8KAY7 (Start-659)
      • conflict (106)
      • expression tag (660-662)
    Domains in SCOPe 2.03: d2yhec1, d2yhec2
  • Chain 'D':
    Compound: sec-alkyl sulfatase
    Species: PSEUDOMONAS SP. DSM 6611 [TaxId:1007495]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8KAY7 (Start-659)
      • conflict (106)
      • expression tag (660-662)
    Domains in SCOPe 2.03: d2yhed1, d2yhed2
  • Chain 'E':
    Compound: sec-alkyl sulfatase
    Species: PSEUDOMONAS SP. DSM 6611 [TaxId:1007495]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8KAY7 (Start-659)
      • conflict (106)
      • expression tag (660-662)
    Domains in SCOPe 2.03: d2yhee1, d2yhee2
  • Chain 'F':
    Compound: sec-alkyl sulfatase
    Species: PSEUDOMONAS SP. DSM 6611 [TaxId:1007495]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8KAY7 (Start-659)
      • conflict (106)
      • expression tag (660-662)
    Domains in SCOPe 2.03: d2yhef1, d2yhef2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yheA (A:)
    msrfirasqrrtllatliaatlaqpllaaesldskpasaitaaknaevlknlpfadreef
    eaakrgliapfsgqiknaegqvvwdmgayqflndkdaadtvnpslwrqaqlnniaglfev
    mpklyqvrgldpanmtiiegdsglvlidtlttaetaraaldlyfqhrpkkpivavvyshs
    hidhfggargiideadvkagkvkvfapsgfmehavsenilagtamarrgqyqsgvmvprg
    aqaqvdsglfkttatnatntlvapnvliekpyerhtvdgvelefqltlgseapsdmniyl
    pqfkvlntadnappamhnlltprgaevrdakawagyidaslekygdrtdvliqqhnwpvw
    ggdkvrtyladqrdmyaflnnralnlmnkgltlheiaaevsklpgeldrkwylrsyygal
    stnlravyqrylgfydgnpanldpfppveagkryveamggadavlkqmraaidkgdyrwa
    vqlgnhlvfadpankdaralqadameqlgyqtenalwrnmymtgamelrhgvptydsrgk
    semgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgsln
    pkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfnive
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yheA (A:)
    esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
    qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
    lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
    fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
    kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
    akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
    gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
    agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
    yqtenalwrnmymtgamelrhgvptydsrgksemgraltpdmffdllairldtdkavghd
    mtlnwvfedlkqdialtlrngvltqrvgslnpkadvtvkltkptldqiaarkldlptaik
    qgtvkldgdgkklgeffglldsfspkfnivelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yheB (B:)
    msrfirasqrrtllatliaatlaqpllaaesldskpasaitaaknaevlknlpfadreef
    eaakrgliapfsgqiknaegqvvwdmgayqflndkdaadtvnpslwrqaqlnniaglfev
    mpklyqvrgldpanmtiiegdsglvlidtlttaetaraaldlyfqhrpkkpivavvyshs
    hidhfggargiideadvkagkvkvfapsgfmehavsenilagtamarrgqyqsgvmvprg
    aqaqvdsglfkttatnatntlvapnvliekpyerhtvdgvelefqltlgseapsdmniyl
    pqfkvlntadnappamhnlltprgaevrdakawagyidaslekygdrtdvliqqhnwpvw
    ggdkvrtyladqrdmyaflnnralnlmnkgltlheiaaevsklpgeldrkwylrsyygal
    stnlravyqrylgfydgnpanldpfppveagkryveamggadavlkqmraaidkgdyrwa
    vqlgnhlvfadpankdaralqadameqlgyqtenalwrnmymtgamelrhgvptydsrgk
    semgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgsln
    pkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfnive
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yheB (B:)
    esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
    qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
    lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
    fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
    kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
    akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
    gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
    agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
    yqtenalwrnmymtgamelrhgvptydsrgksemgraltpdmffdllairldtdkavghd
    mtlnwvfedlkqdialtlrngvltqrvgslnpkadvtvkltkptldqiaarkldlptaik
    qgtvkldgdgkklgeffglldsfspkfniveleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yheC (C:)
    msrfirasqrrtllatliaatlaqpllaaesldskpasaitaaknaevlknlpfadreef
    eaakrgliapfsgqiknaegqvvwdmgayqflndkdaadtvnpslwrqaqlnniaglfev
    mpklyqvrgldpanmtiiegdsglvlidtlttaetaraaldlyfqhrpkkpivavvyshs
    hidhfggargiideadvkagkvkvfapsgfmehavsenilagtamarrgqyqsgvmvprg
    aqaqvdsglfkttatnatntlvapnvliekpyerhtvdgvelefqltlgseapsdmniyl
    pqfkvlntadnappamhnlltprgaevrdakawagyidaslekygdrtdvliqqhnwpvw
    ggdkvrtyladqrdmyaflnnralnlmnkgltlheiaaevsklpgeldrkwylrsyygal
    stnlravyqrylgfydgnpanldpfppveagkryveamggadavlkqmraaidkgdyrwa
    vqlgnhlvfadpankdaralqadameqlgyqtenalwrnmymtgamelrhgvptydsrgk
    semgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgsln
    pkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfnive
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yheC (C:)
    esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
    qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
    lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
    fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
    kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
    akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
    gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
    agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
    yqtenalwrnmymtgamelrhgvptydsrgksemgraltpdmffdllairldtdkavghd
    mtlnwvfedlkqdialtlrngvltqrvgslnpkadvtvkltkptldqiaarkldlptaik
    qgtvkldgdgkklgeffglldsfspkfniveleh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yheD (D:)
    msrfirasqrrtllatliaatlaqpllaaesldskpasaitaaknaevlknlpfadreef
    eaakrgliapfsgqiknaegqvvwdmgayqflndkdaadtvnpslwrqaqlnniaglfev
    mpklyqvrgldpanmtiiegdsglvlidtlttaetaraaldlyfqhrpkkpivavvyshs
    hidhfggargiideadvkagkvkvfapsgfmehavsenilagtamarrgqyqsgvmvprg
    aqaqvdsglfkttatnatntlvapnvliekpyerhtvdgvelefqltlgseapsdmniyl
    pqfkvlntadnappamhnlltprgaevrdakawagyidaslekygdrtdvliqqhnwpvw
    ggdkvrtyladqrdmyaflnnralnlmnkgltlheiaaevsklpgeldrkwylrsyygal
    stnlravyqrylgfydgnpanldpfppveagkryveamggadavlkqmraaidkgdyrwa
    vqlgnhlvfadpankdaralqadameqlgyqtenalwrnmymtgamelrhgvptydsrgk
    semgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgsln
    pkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfnive
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yheD (D:)
    esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
    qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
    lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
    fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
    kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
    akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
    gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
    agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
    yqtenalwrnmymtgamelrhgvptydsrgksemgraltpdmffdllairldtdkavghd
    mtlnwvfedlkqdialtlrngvltqrvgslnpkadvtvkltkptldqiaarkldlptaik
    qgtvkldgdgkklgeffglldsfspkfniveleh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yheE (E:)
    msrfirasqrrtllatliaatlaqpllaaesldskpasaitaaknaevlknlpfadreef
    eaakrgliapfsgqiknaegqvvwdmgayqflndkdaadtvnpslwrqaqlnniaglfev
    mpklyqvrgldpanmtiiegdsglvlidtlttaetaraaldlyfqhrpkkpivavvyshs
    hidhfggargiideadvkagkvkvfapsgfmehavsenilagtamarrgqyqsgvmvprg
    aqaqvdsglfkttatnatntlvapnvliekpyerhtvdgvelefqltlgseapsdmniyl
    pqfkvlntadnappamhnlltprgaevrdakawagyidaslekygdrtdvliqqhnwpvw
    ggdkvrtyladqrdmyaflnnralnlmnkgltlheiaaevsklpgeldrkwylrsyygal
    stnlravyqrylgfydgnpanldpfppveagkryveamggadavlkqmraaidkgdyrwa
    vqlgnhlvfadpankdaralqadameqlgyqtenalwrnmymtgamelrhgvptydsrgk
    semgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgsln
    pkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfnive
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yheE (E:)
    esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
    qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
    lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
    fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
    kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
    akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
    gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
    agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
    yqtenalwrnmymtgamelrhgvptydsrgksemgraltpdmffdllairldtdkavghd
    mtlnwvfedlkqdialtlrngvltqrvgslnpkadvtvkltkptldqiaarkldlptaik
    qgtvkldgdgkklgeffglldsfspkfniveleh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yheF (F:)
    msrfirasqrrtllatliaatlaqpllaaesldskpasaitaaknaevlknlpfadreef
    eaakrgliapfsgqiknaegqvvwdmgayqflndkdaadtvnpslwrqaqlnniaglfev
    mpklyqvrgldpanmtiiegdsglvlidtlttaetaraaldlyfqhrpkkpivavvyshs
    hidhfggargiideadvkagkvkvfapsgfmehavsenilagtamarrgqyqsgvmvprg
    aqaqvdsglfkttatnatntlvapnvliekpyerhtvdgvelefqltlgseapsdmniyl
    pqfkvlntadnappamhnlltprgaevrdakawagyidaslekygdrtdvliqqhnwpvw
    ggdkvrtyladqrdmyaflnnralnlmnkgltlheiaaevsklpgeldrkwylrsyygal
    stnlravyqrylgfydgnpanldpfppveagkryveamggadavlkqmraaidkgdyrwa
    vqlgnhlvfadpankdaralqadameqlgyqtenalwrnmymtgamelrhgvptydsrgk
    semgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgsln
    pkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfnive
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yheF (F:)
    esldskpasaitaaknaevlknlpfadreefeaakrgliapfsgqiknaegqvvwdmgay
    qflndkdaadtvnpslwrqaqlnniaglfevmpklyqvrgldpanmtiiegdsglvlidt
    lttaetaraaldlyfqhrpkkpivavvyshshidhfggargiideadvkagkvkvfapsg
    fmehavsenilagtamarrgqyqsgvmvprgaqaqvdsglfkttatnatntlvapnvlie
    kpyerhtvdgvelefqltlgseapsdmniylpqfkvlntadnappamhnlltprgaevrd
    akawagyidaslekygdrtdvliqqhnwpvwggdkvrtyladqrdmyaflnnralnlmnk
    gltlheiaaevsklpgeldrkwylrsyygalstnlravyqrylgfydgnpanldpfppve
    agkryveamggadavlkqmraaidkgdyrwavqlgnhlvfadpankdaralqadameqlg
    yqtenalwrnmymtgamelrhgvptydsrgksemgraltpdmffdllairldtdkavghd
    mtlnwvfedlkqdialtlrngvltqrvgslnpkadvtvkltkptldqiaarkldlptaik
    qgtvkldgdgkklgeffglldsfspkfniveleh