PDB entry 2ygx

View 2ygx on RCSB PDB site
Description: Structure of the mixed-function P450 MycG in P21 space group
Class: electron transport
Keywords: electron transport, mycinamicin biosynthesis, metal binding
Deposited on 2011-04-22, released 2012-02-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.18733
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ygxa_
  • Chain 'B':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ygxb_
  • Chain 'C':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ygxc_
  • Chain 'D':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ygxd_
  • Heterogens: HEM, GOL, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ygxA (A:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ygxA (A:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ygxB (B:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ygxB (B:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ygxC (C:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ygxC (C:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ygxD (D:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtafpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ygxD (D:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtafpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw