PDB entry 2ygs

View 2ygs on RCSB PDB site
Description: card domain from apaf-1
Deposited on 1999-05-08, released 2000-04-19
The last revision prior to the SCOP 1.57 freeze date was dated 2000-04-19, with a file datestamp of 2000-04-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2ygsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ygsA (A:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgip