PDB entry 2yfw

View 2yfw on RCSB PDB site
Description: heterotetramer structure of kluyveromyces lactis cse4,h4
Class: cell cycle
Keywords: cell cycle, kinetochore, centromere, histone chaperone, budding yeast
Deposited on 2011-04-08, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22112
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3-like centromeric protein cse4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwa_
  • Chain 'B':
    Compound: histone h4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwb_
  • Chain 'C':
    Compound: histone h3-like centromeric protein cse4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwc_
  • Chain 'D':
    Compound: histone h4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwd_
  • Chain 'E':
    Compound: histone h3-like centromeric protein cse4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwe_
  • Chain 'F':
    Compound: histone h4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwf_
  • Chain 'G':
    Compound: histone h3-like centromeric protein cse4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwg_
  • Chain 'H':
    Compound: histone h4
    Species: KLUYVEROMYCES LACTIS NRRL Y-1140 [TaxId:284590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yfwh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yfwA (A:)
    alaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgl
    lehtnllalhakritimrkdmqlarrirgqfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwA (A:)
    dllisrmpfarlvkevtdqftteeplrwqsmaimalqeaseaylvgllehtnllalhakr
    itimrkdmqlarrirgqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yfwB (B:)
    msgrgkggkglgkggakrhrkilrdniqgitkpairrlarrggvkrisgliyeevrnvlk
    tflesvirdavtytehakrktvtsldvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwB (B:)
    itkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvtsldvvy
    alkrqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yfwC (C:)
    alaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgl
    lehtnllalhakritimrkdmqlarrirgqfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwC (C:)
    tdllisrmpfarlvkevtdqlrwqsmaimalqeaseaylvgllehtnllalhakritimr
    kdmqlarrirg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yfwD (D:)
    msgrgkggkglgkggakrhrkilrdniqgitkpairrlarrggvkrisgliyeevrnvlk
    tflesvirdavtytehakrktvtsldvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwD (D:)
    dniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvts
    ldvvyalkrqg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yfwE (E:)
    alaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgl
    lehtnllalhakritimrkdmqlarrirgqfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwE (E:)
    alaeirkyqrstdllisrmpfarlvkevtdqftplrwqsmaimalqeaseaylvglleht
    nllalhakritimrkdmqlarrirgqfi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yfwF (F:)
    msgrgkggkglgkggakrhrkilrdniqgitkpairrlarrggvkrisgliyeevrnvlk
    tflesvirdavtytehakrktvtsldvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwF (F:)
    rdniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvt
    sldvvyalkrqg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yfwG (G:)
    alaeirkyqrstdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgl
    lehtnllalhakritimrkdmqlarrirgqfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwG (G:)
    tdllisrmpfarlvkevtdqftteseplrwqsmaimalqeaseaylvgllehtnllalha
    kritimrkdmqlarrirg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yfwH (H:)
    msgrgkggkglgkggakrhrkilrdniqgitkpairrlarrggvkrisgliyeevrnvlk
    tflesvirdavtytehakrktvtsldvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfwH (H:)
    rdniqgitkpairrlarrggvkrisgliyeevrnvlktflesvirdavtytehakrktvt
    sldvvyalkrqgrtlygfgg