PDB entry 2yfq

View 2yfq on RCSB PDB site
Description: Crystal structure of Glutamate dehydrogenase from Peptoniphilus asaccharolyticus
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-04-07, released 2011-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.24389
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-specific glutamate dehydrogenase
    Species: Peptoniphilus asaccharolyticus [TaxId:1258]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfqa1, d2yfqa2
  • Chain 'B':
    Compound: nad-specific glutamate dehydrogenase
    Species: Peptoniphilus asaccharolyticus [TaxId:1258]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yfqb1, d2yfqb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yfqA (A:)
    mtdtlnplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrs
    ahssavgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsere
    leqlsrgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpva
    fggsegrneatgfgvavvvresakrfgikmedakiavqgfgnvgtftvknierqggkvca
    iaewdrnegnyalynengidfkellaykeanktligfpgaeritdeefwtkeydiivpaa
    lenvitgeraktinaklvceaangpttpegdkvlterginltpdiltnsggvlvsyyewv
    qnqygyywteaeveekqeadmmkaikgvfavadeynvtlreavymyaiksidvamklrgw
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfqA (A:)
    nplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrsahssa
    vgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsereleqls
    rgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpvafggse
    grneatgfgvavvvresakrfgikmedakiavqgfgnvgtftvknierqggkvcaiaewd
    rnegnyalynengidfkellaykeanktiivpaalenvitgeraktinaklvceaangpt
    tpegdkvlterginltpdiltnsggvlvsyyewvqnqygyywteaeveekqeadmmkaik
    gvfavadeynvtlreavymyaiksidvamklrgwy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yfqB (B:)
    mtdtlnplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrs
    ahssavgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsere
    leqlsrgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpva
    fggsegrneatgfgvavvvresakrfgikmedakiavqgfgnvgtftvknierqggkvca
    iaewdrnegnyalynengidfkellaykeanktligfpgaeritdeefwtkeydiivpaa
    lenvitgeraktinaklvceaangpttpegdkvlterginltpdiltnsggvlvsyyewv
    qnqygyywteaeveekqeadmmkaikgvfavadeynvtlreavymyaiksidvamklrgw
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfqB (B:)
    lnplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrsahss
    avgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsereleql
    srgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpvafggs
    egrneatgfgvavvvresakrfgikmedakiavqgfgnvgtftvknierqggkvcaiaew
    drnegnyalynengidfkellaykeanktdiivpaalenvitgeraktinaklvceaang
    pttpegdkvlterginltpdiltnsggvlvsyyewvqnqygyywteaeveekqeadmmka
    ikgvfavadeynvtlreavymyaiksidvamklrgwy