PDB entry 2yfj

View 2yfj on RCSB PDB site
Description: crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-04-06, released 2011-06-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.20509
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
      • engineered mutation (408)
  • Chain 'B':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yfjb_
  • Chain 'C':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
      • engineered mutation (408)
  • Chain 'D':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yfjd_
  • Chain 'E':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
      • engineered mutation (408)
  • Chain 'F':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yfjf_
  • Chain 'G':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
      • engineered mutation (408)
  • Chain 'H':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yfjh_
  • Chain 'I':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
      • engineered mutation (408)
  • Chain 'J':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yfjj_
  • Chain 'K':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
      • engineered mutation (408)
  • Chain 'L':
    Compound: Biphenyl dioxygenase subunit beta
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2yfjl_
  • Heterogens: FES, FE2, 1IT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yfjB (B:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfjB (B:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yfjD (D:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfjD (D:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yfjF (F:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfjF (F:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yfjH (H:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfjH (H:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2yfjJ (J:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfjJ (J:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2yfjL (L:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfjL (L:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff