PDB entry 2yfh

View 2yfh on RCSB PDB site
Description: Structure of a Chimeric Glutamate Dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, chimera
Deposited on 2011-04-05, released 2012-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2184
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase
    Species: CLOSTRIDIUM SYMBIOSUM, ESCHERICHIA COLI, CLOSTRIDIUM SYMBIOSUM [TaxId:1512, 562, 1512]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yfha1, d2yfha2
  • Chain 'B':
    Compound: glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase
    Species: CLOSTRIDIUM SYMBIOSUM, ESCHERICHIA COLI, CLOSTRIDIUM SYMBIOSUM [TaxId:1512, 562, 1512]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yfhb1, d2yfhb2
  • Chain 'C':
    Compound: glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase
    Species: CLOSTRIDIUM SYMBIOSUM, ESCHERICHIA COLI, CLOSTRIDIUM SYMBIOSUM [TaxId:1512, 562, 1512]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yfhc1, d2yfhc2
  • Chain 'D':
    Compound: glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase
    Species: CLOSTRIDIUM SYMBIOSUM, ESCHERICHIA COLI, CLOSTRIDIUM SYMBIOSUM [TaxId:1512, 562, 1512]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yfhd1, d2yfhd2
  • Chain 'E':
    Compound: glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase
    Species: CLOSTRIDIUM SYMBIOSUM, ESCHERICHIA COLI, CLOSTRIDIUM SYMBIOSUM [TaxId:1512, 562, 1512]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yfhe1, d2yfhe2
  • Chain 'F':
    Compound: glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase
    Species: CLOSTRIDIUM SYMBIOSUM, ESCHERICHIA COLI, CLOSTRIDIUM SYMBIOSUM [TaxId:1512, 562, 1512]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yfhf1, d2yfhf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yfhA (A:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefg
    lvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqq
    agvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryg
    lgynlvaganivgfqkiadammaqgiaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfhA (A:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieidgrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryglgyn
    lvaganivgfqkiadammaqgiaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yfhB (B:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefg
    lvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqq
    agvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryg
    lgynlvaganivgfqkiadammaqgiaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfhB (B:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgn
    vaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefgl
    vylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqa
    gvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaerygl
    gynlvaganivgfqkiadammaqgiaw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yfhC (C:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefg
    lvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqq
    agvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryg
    lgynlvaganivgfqkiadammaqgiaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfhC (C:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgn
    vaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefgl
    vylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqa
    gvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaerygl
    gynlvaganivgfqkiadammaqgiaw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yfhD (D:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefg
    lvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqq
    agvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryg
    lgynlvaganivgfqkiadammaqgiaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfhD (D:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgn
    vaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikagrvadyakefglvyl
    egqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryglgyn
    lvaganivgfqkiadammaqgiaw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yfhE (E:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefg
    lvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqq
    agvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryg
    lgynlvaganivgfqkiadammaqgiaw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yfhF (F:)
    mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
    frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
    pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
    yrkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsg
    nvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefg
    lvylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqq
    agvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryg
    lgynlvaganivgfqkiadammaqgiaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yfhF (F:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgn
    vaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefgl
    vylegqqpwslpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqa
    gvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaerygl
    gynlvaganivgfqkiadammaqgiaw