PDB entry 2yf9

View 2yf9 on RCSB PDB site
Description: structural and functional insights of dr2231 protein, the mazg-like nucleoside triphosphate pyrophosphohydrolase from deinococcus radiodurans, native form
Deposited on 2011-04-04, released 2011-07-06
The last revision was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mazg-like nucleoside triphosphate pyrophosphohydrolase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RS96
      • expression tag (1-5)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2yf9A (A:)
gidpftmsdlpcpptnaerlhefhraigaatperptppppellrlrqtlldeesaevrae
idhllarqaagealsagdlaplaheladllyvtygaldqlgidadavfaevhranlskas
gprradgkqlkpegwrpadvrgvierlqhapadd

    Sequence, based on observed residues (ATOM records):
    >2yf9A (A:)
idpftpptnaerlhefhraigatperptppppellrlrqtlldeesaevraeidhllarq
aagealsagdlaplaheladllyvtygaldqlgidadavfaevhranlskasgprradgk
qlkpegwrpadvrgvierlqh