PDB entry 2yex

View 2yex on RCSB PDB site
Description: Synthesis and evaluation of triazolones as checkpoint kinase 1 inhibitors
Class: transferase
Keywords: transferase, cell cycle, chk
Deposited on 2011-03-31, released 2012-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.13503
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yexa_
  • Heterogens: GOL, YEX, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yexA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yexA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplk