PDB entry 2yem

View 2yem on RCSB PDB site
Description: Crystal Structure of the Second Bromodomain of Human Brd4 with the inhibitor GW841819X
Class: signaling protein
Keywords: signaling protein, histone, epigenetic reader
Deposited on 2011-03-25, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18246
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yema_
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yemb_
  • Heterogens: WSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yemA (A:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yemA (A:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yemB (B:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yemB (B:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd