PDB entry 2ydx

View 2ydx on RCSB PDB site
Description: Crystal structure of human S-adenosylmethionine synthetase 2, beta subunit
Class: oxidoreductase
Keywords: oxidoreductase, transferase
Deposited on 2011-03-25, released 2011-04-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.1686
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine adenosyltransferase 2 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZL9 (1-307)
      • expression tag (0)
      • expression tag (308-311)
    Domains in SCOPe 2.05: d2ydxa_
  • Chain 'B':
    Compound: methionine adenosyltransferase 2 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZL9 (1-307)
      • expression tag (0)
      • expression tag (308-311)
    Domains in SCOPe 2.05: d2ydxb_
  • Chain 'C':
    Compound: methionine adenosyltransferase 2 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZL9 (1-307)
      • expression tag (0)
      • expression tag (308-311)
    Domains in SCOPe 2.05: d2ydxc_
  • Chain 'D':
    Compound: methionine adenosyltransferase 2 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZL9 (1-307)
      • expression tag (0)
      • expression tag (308-311)
    Domains in SCOPe 2.05: d2ydxd_
  • Chain 'E':
    Compound: methionine adenosyltransferase 2 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZL9 (1-307)
      • expression tag (0)
      • expression tag (308-311)
    Domains in SCOPe 2.05: d2ydxe_
  • Heterogens: STL, NAP, SO4, CA, TXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ydxA (A:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydxA (A:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ydxB (B:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydxB (B:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ydxC (C:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydxC (C:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ydxD (D:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydxD (D:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ydxE (E:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydxE (E:)
    mnrrvlvtgatgllgravhkefqqnnwhavgcgfrrarpkfeqvnlldsnavhhiihdfq
    phvivhcaaerrpdvvenqpdaasqlnvdasgnlakeaaavgafliyissdyvfdgtnpp
    yreedipaplnlygktkldgekavlennlgaavlripilygevekleesavtvmfdkvqf
    snksanmdhwqqrfpthvkdvatvcrqlaekrmldpsikgtfhwsgneqmtkyemacaia
    dafnlpsshlrpitdspvlgaqrprnaqldcskletlgigqrtpfrigikeslwpflidk
    rwrqtvfhaenl