PDB entry 2ydm

View 2ydm on RCSB PDB site
Description: structural characterization of angiotensin-I converting enzyme in complex with a selenium analogue of captopril
Class: hydrolase
Keywords: hydrolase, antihypertensive agents
Deposited on 2011-03-22, released 2011-09-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.21684
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821
      • conflict (579)
    Domains in SCOPe 2.02: d2ydma_
  • Heterogens: ZN, CL, NAG, SLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ydmA (A:)
    lvtdeaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpng
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    nksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpnmsasamlsyfkplldwlrtenelhgeklgwqqynwtpns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydmA (A:)
    deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
    rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
    qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
    wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
    aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
    mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
    alreganpgfheaigdvlalsvstpkhlhslnllssdehdinflmkmaldkiafipfsyl
    vdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpyiry
    fvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitg
    qpnmsasamlsyfkplldwlrtenelhgeklgwqq