PDB entry 2ydl

View 2ydl on RCSB PDB site
Description: Crystal structure of SH3C from CIN85
Class: signaling protein
Keywords: signaling protein
Deposited on 2011-03-22, released 2012-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.2074
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain-containing kinase-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96B97 (2-60)
      • expression tag (0-1)
      • expression tag (61-66)
    Domains in SCOPe 2.08: d2ydla1, d2ydla2, d2ydla3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ydlA (A:)
asdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpdnfvkllp
plehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2ydlA (A:)
asdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpdnfvkllp
plehhhh