PDB entry 2ydk

View 2ydk on RCSB PDB site
Description: Discovery of Checkpoint Kinase Inhibitor AZD7762 by Structure Based Design and Optimization of Thiophene Carboxamide Ureas
Class: transferase
Keywords: transferase
Deposited on 2011-03-22, released 2012-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18303
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ydka_
  • Heterogens: SO4, GOL, YDK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ydkA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydkA (A:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrenikkeicinkmlnhenv
    vkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigit
    hrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhae
    pvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilv
    enpsaritipdikkdrwynkplk