PDB entry 2ydj

View 2ydj on RCSB PDB site
Description: Discovery of Checkpoint Kinase Inhibitor AZD7762 by Structure Based Design and Optimization of Thiophene Carboxamide Ureas
Class: transferase
Keywords: transferase
Deposited on 2011-03-22, released 2012-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.23094
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ydja_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ydjb_
  • Heterogens: YDJ, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ydjA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydjA (A:)
    dwdlvqtlgegaygevqlavnrvteeavavkivdmnikkeicinkmlnhenvvkfyghrr
    egniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpen
    lllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscg
    ivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsarit
    ipdikkdrwynkpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ydjB (B:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydjB (B:)
    wdlvqtlgegaygevqlavnrvteeavavkivdmnikkeicinkmlnhenvvkfyghrre
    gniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenl
    llderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgi
    vltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsariti
    pdikkdrwynkpl