PDB entry 2yd8

View 2yd8 on RCSB PDB site
Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase lar in complex with sucrose octasulphate
Class: hydrolase
Keywords: hydrolase, rptpf
Deposited on 2011-03-18, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1965
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yd8a1, d2yd8a2
  • Heterogens: SCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yd8A (A:)
    etgdskpvfikvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefddg
    agsvlriqplrvqrdeaiyectatnslgeintsaklsvleeeqlppgfpsidmgpqlkvv
    ekartatmlcaaggnpdpeiswfkdflpvdpatsngrikqlrsgalqiesseesdqgkye
    cvatnsagtrysapanlyvrvrrvagtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yd8A (A:)
    dskpvfikvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefddgags
    vlriqplrvqrdeaiyectatnslgeintsaklsvleeeqlppgfpsidmgpqlkvveka
    rtatmlcaaggnpdpeiswfkdflpvdpatsngrikqlrsgalqiesseesdqgkyecva
    tnsagtrysapanlyvrv