PDB entry 2yd6

View 2yd6 on RCSB PDB site
Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase delta
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-03-17, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.142
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ptprd protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KPJ2 (3-202)
      • expression tag (203)
    Domains in SCOPe 2.06: d2yd6a1, d2yd6a2, d2yd6a3
  • Heterogens: CL, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yd6A (A:)
    etgetpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddg
    sgsvlriqplrtprdeaiyecvasnnvgeisvstrltvlredqiprgfptidmgpqlkvv
    ertrtatmlcaasgnpdpeitwfkdflpvdtsnnngrikqlrsesigalqieqseesdqg
    kyecvatnsagtrysapanlyvrgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yd6A (A:)
    etpprftrtpvdqtgvsggvasficqatgdprpkivwnkkgkkvsnqrfeviefddgsgs
    vlriqplrtprdeaiyecvasnnvgeisvstrltvlredqiprgfptidmgpqlkvvert
    rtatmlcaasgnpdpeitwfkdflpvgrikqlrsesigalqieqseesdqgkyecvatns
    agtrysapanlyvrg