PDB entry 2yd5

View 2yd5 on RCSB PDB site
Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase lar
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-03-17, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1973
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yd5a1, d2yd5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yd5A (A:)
    etgdskpvfikvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefddg
    agsvlriqplrvqrdeaiyectatnslgeintsaklsvleeeqlppgfpsidmgpqlkvv
    ekartatmlcaaggnpdpeiswfkdflpvdpatsngrikqlrsgalqiesseesdqgkye
    cvatnsagtrysapanlyvrvrrvagtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yd5A (A:)
    dskpvfikvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefddgags
    vlriqplrvqrdeaiyectatnslgeintsaklsvleeeqlppgfpsidmgpqlkvveka
    rtatmlcaaggnpdpeiswfkdflpvdpatsngrikqlrsgalqiesseesdqgkyecva
    tnsagtrysapanlyvrvr