PDB entry 2yd0

View 2yd0 on RCSB PDB site
Description: Crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 ERAP1
Class: hydrolase
Keywords: hydrolase, glycoprotein, metal-binding, metalloprotease, protease, adaptive immunity
Deposited on 2011-03-17, released 2011-04-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.15496
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yd0a1, d2yd0a2, d2yd0a3, d2yd0a4
  • Heterogens: NAG, ZN, K, EDO, BES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yd0A (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
    tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
    tvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyalda
    avtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssasskl
    gitmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcf
    damevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqyl
    qkhsykntknedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwt
    lqkgfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktk
    tdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndraslinnafq
    lvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmnevetqfkaflir
    llrdlidkqtwtdegsvsermlrsqllllacvhnyqpcvqraegyfrkwkesngnlslpv
    dvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwlldesfkgd
    kiktqefpqiltligrnpvgyplawqflrknwnklvqkfelgsssiahmvmgttnqfstr
    trleevkgffsslkengsqlrcvqqtietieenigwmdknfdkirvwlqseklerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yd0A (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkglseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
    kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
    gliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtl
    lefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitm
    tvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdame
    vdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhs
    ykntknedlwdsmasigvdvktmmntwtlqkgfplititvrgrnvhmkqehymkgdtgyl
    whvpltfitsksdmvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltg
    llkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvfqglnelip
    myklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllllacvhnyqp
    cvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqie
    falcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvq
    kfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtietieenigwm
    dknfdkirvwlqsekler