PDB entry 2yct

View 2yct on RCSB PDB site
Description: tyrosine phenol-lyase from citrobacter freundii in complex with pyridine n-oxide and the quinonoid intermediate formed with l-alanine
Class: lyase
Keywords: lyase, pyridoxal 5'-phosphate dependent enzyme, beta-elimination
Deposited on 2011-03-16, released 2011-09-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.14003
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ycta_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yctb_
  • Heterogens: PLP, PLI, K, 9PO, PO4, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yctA (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yctA (A:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yctB (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yctB (B:)
    nypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqw
    agmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagnm
    yftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicla
    vtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaeiv
    hemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdmea
    maiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqdef
    paqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvva
    dgiiklyqhkedirglkfiyepkqlrfftarfdyi