PDB entry 2yci

View 2yci on RCSB PDB site
Description: methyltransferase native
Class: transferase
Keywords: transferase
Deposited on 2011-03-16, released 2011-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.19281
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase
    Species: Carboxydothermus hydrogenoformans [TaxId:246194]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3ACR9 (8-270)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2ycix1, d2ycix2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yciX (X:)
glvprgshmfimigeringmfkdireailnkdprpiqewarrqaekgahyldvntgptad
dpvrvmewlvktiqevvdlpccldstnpdaieaglkvhrghaminstsadqwkmdiffpm
akkyeaaiigltmnekgvpkdandrsqlamelvanadahgipmtelyidplilpvnvaqe
havevletirqiklmanpaprtvlglsnvsqkcpdrplinrtylvmamtagldaaimdvd
ddalvdaaatahillnkeiycdsylktfrqk