PDB entry 2yce

View 2yce on RCSB PDB site
Description: structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate.
Class: lyase
Keywords: lyase, glycolysis
Deposited on 2011-03-14, released 2011-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.15654
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2ycea1
  • Chain 'B':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2yceb_
  • Chain 'C':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2ycec_
  • Chain 'D':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2yced_
  • Chain 'E':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2ycee_
  • Chain 'F':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2ycef_
  • Chain 'G':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2yceg_
  • Chain 'H':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2yceh_
  • Chain 'I':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2ycei_
  • Chain 'J':
    Compound: fructose-bisphosphate aldolase class 1
    Species: Thermoproteus tenax [TaxId:2271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58315
      • engineered mutation (145)
      • engineered mutation (172)
    Domains in SCOPe 2.06: d2ycej_
  • Heterogens: M2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yceA (A:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceA (A:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yceB (B:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceB (B:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yceC (C:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceC (C:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yceD (D:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceD (D:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yceE (E:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceE (E:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyggkkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yceF (F:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceF (F:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yceG (G:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceG (G:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yceH (H:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceH (H:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2yceI (I:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceI (I:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2yceJ (J:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yceJ (J:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsfprggkvvnetapeivayaarialelgsdamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvy